<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21747
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSVHPQTPQSPCRFSPATSSDSVMGLAVASATSASGAAAAAVSSSAASAAAAASTTSSCSLATLPTPAHSVNGANCQPDLGLVDSPHKRKRTLDDAGSGRDRKKMHRDDDDDDDRMGIEDLHLDVGRKYLLCQNTYPESLPPTSEDLYQMFGLTALAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKNEDAPSDFLAMLAVPELEWNVHQVKGRDISQGLSETTLSNLGRAVTLSRGSLPKSVWDSSVLGDLAPAASDGSKPQSAKATAPSTPLASTPNAMGRSKAQLPVGAGDVARPRRNNKKRSYGDSSFEGYGEGYPDDDAGVDTGYSTGEGDGGQKRRKKNPSNSPTYSSMRQQSYGPGMVGA |
| Length | 374 |
| Position | Head |
| Organism | Ophiocordyceps sp. 'camponoti-leonardi' |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.667 |
| Instability index | 49.64 |
| Isoelectric point | 7.69 |
| Molecular weight | 39252.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21747
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.01| 15| 15| 81| 95| 1
---------------------------------------------------------------------------
81- 95 (26.30/13.95) GLVDSPHKRKRTLDD
97- 111 (27.71/15.02) GSGRDRKKMHRDDDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.60| 19| 21| 273| 291| 2
---------------------------------------------------------------------------
258- 276 (27.77/12.26) DLAPAASDGSKPQSAKATA
277- 295 (29.83/13.68) PSTPLASTPNAMGRSKAQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.51| 22| 23| 27| 48| 3
---------------------------------------------------------------------------
27- 48 (32.30/14.12) AVASATSASGAAAAAVSSSAAS
49- 70 (35.22/15.96) AAAAASTTSSCSLATLPTPAHS
---------------------------------------------------------------------------
|