Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSVHPQTPQSPCRFSPATSSDSVMGLAVASATSASGAAAAAVSSSAASAAAAASTTSSCSLATLPTPAHSVNGANCQPDLGLVDSPHKRKRTLDDAGSGRDRKKMHRDDDDDDDRMGIEDLHLDVGRKYLLCQNTYPESLPPTSEDLYQMFGLTALAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKNEDAPSDFLAMLAVPELEWNVHQVKGRDISQGLSETTLSNLGRAVTLSRGSLPKSVWDSSVLGDLAPAASDGSKPQSAKATAPSTPLASTPNAMGRSKAQLPVGAGDVARPRRNNKKRSYGDSSFEGYGEGYPDDDAGVDTGYSTGEGDGGQKRRKKNPSNSPTYSSMRQQSYGPGMVGA |
Length | 374 |
Position | Head |
Organism | Ophiocordyceps sp. 'camponoti-leonardi' |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.667 |
Instability index | 49.64 |
Isoelectric point | 7.69 |
Molecular weight | 39252.94 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21747 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.01| 15| 15| 81| 95| 1 --------------------------------------------------------------------------- 81- 95 (26.30/13.95) GLVDSPHKRKRTLDD 97- 111 (27.71/15.02) GSGRDRKKMHRDDDD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.60| 19| 21| 273| 291| 2 --------------------------------------------------------------------------- 258- 276 (27.77/12.26) DLAPAASDGSKPQSAKATA 277- 295 (29.83/13.68) PSTPLASTPNAMGRSKAQL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.51| 22| 23| 27| 48| 3 --------------------------------------------------------------------------- 27- 48 (32.30/14.12) AVASATSASGAAAAAVSSSAAS 49- 70 (35.22/15.96) AAAAASTTSSCSLATLPTPAHS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GQKRRKKNPSN 2) GVDTGY 3) RKKMH | 345 332 102 | 355 337 106 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab