<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21712
| Description |
Uncharacterized protein |
| Sequence | MEVSLAQQNFAFLFACVLLPLPGGGRRERERGEGGFAMDIITQLQEQLSEIAMLAVNTFGTLQRDAPPDRLSTSYPDPLNPNPKPEEDAKPQVQAPPGAAPAQAQPPAPPQAPALDLAEQPKAMSHALVLAAKKFDALVAALPLSSEEDQLKRIQELQAENEVVGLELQKQLEAAELELKQVEVLFNEATDNCINLKKPE |
| Length | 200 |
| Position | Middle |
| Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.338 |
| Instability index | 56.59 |
| Isoelectric point | 4.55 |
| Molecular weight | 21691.44 |
| Publications | PubMed=22580951
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP21712
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 223.57| 72| 122| 5| 77| 1
---------------------------------------------------------------------------
5- 77 (120.16/76.13) LAQQNFAFLFACVL...........LPLPGGGRRERERGEGGFAMDIIT.QLQEQLsEIAMLAVNTFGTLQRDAPPDRLSTSYPD
117- 200 (103.41/61.21) LAEQPKAMSHALVLaakkfdalvaaLPLSSEEDQLKRIQELQAENEVVGlELQKQL.EAAELELKQVEVLFNEATDNCINLKKPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.83| 11| 25| 78| 88| 2
---------------------------------------------------------------------------
78- 88 (21.94/ 9.18) PLNPNPKPEED
106- 116 (21.89/ 9.15) PPAPPQAPALD
---------------------------------------------------------------------------
|