<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21706
| Description |
Uncharacterized protein |
| Sequence | MDSDEKKFGKGPRELTGAVDLINHYKLLPHHDFFCKKPLPPAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYMRDKPAFIQPFDMEILGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDRDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSVHHDSAGDHSKKHHDKKRKHEGNEDSADVHKHKKSKHKSSKTDEMGNGLS |
| Length | 220 |
| Position | Head |
| Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.586 |
| Instability index | 34.06 |
| Isoelectric point | 9.38 |
| Molecular weight | 25357.26 |
| Publications | PubMed=22580951
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP21706
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.28| 15| 33| 117| 131| 2
---------------------------------------------------------------------------
117- 131 (26.27/ 8.08) KPKSESKDKEKKHKK
155- 169 (24.01/ 6.75) KDKDKDKDKDKKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.68| 15| 19| 69| 87| 4
---------------------------------------------------------------------------
69- 87 (23.18/29.83) LVQNAYMRDKPafiqPFDM
90- 104 (25.51/19.20) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|