<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21702
Description |
Uncharacterized protein |
Sequence | MAANFWASSHCKQLLDNPEDADLVPAADRERGITPEEFRLVKIHMSFHIWRLAQQVKVRQRVIATAVTYFRRVYTRKSMSEYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMCGTGSDDKYRFEIKDILEMEMKLLEALDYYLVVFHPYRPLLQLLQDAGITDLTQFAWGLVNDTYKMDLILIYAPYMIALACIYIASVLKDKDTTSWFEELRVDMNIVKNISMEILDFYDTYKIDPQRGLPEDKISPVLNKLPAKS |
Length | 260 |
Position | Kinase |
Organism | Setaria italica (Foxtail millet) (Panicum italicum) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Panicodae> Paniceae> Cenchrinae> Setaria.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.100 |
Instability index | 47.88 |
Isoelectric point | 6.13 |
Molecular weight | 30272.93 |
Publications | PubMed=22580951
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP21702
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.76| 10| 26| 61| 70| 3
---------------------------------------------------------------------------
61- 70 (16.64/ 9.55) RVIATAVTYF
85- 94 (18.12/10.92) RLVAPTCLYL
---------------------------------------------------------------------------
|