<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21680

Description Mediator of RNA polymerase II transcription subunit 12
SequenceMSTKSRNRNSLLSSYSRSSYSNSSTKDEILAMKYLMQEPDLPIYPLSDHARKSSSASSTTNLTDTKTHTLQDQVEPAYPDFMPWKDHTQLSAEQQEKEHQKLNNASYLNKGYFETPQVANEYYSARNLILATVFLSNDNCNTVVKELSAYLTNAYKTRNEVINKIRGDSNHFKIPNRVTLTSNKKEAWLKELSNCSIPLQKIGEKIPHGLRNKVLIDAVCSRGVPINRSIWLTKCVLYGELISLRRKHQNRMSVSGTIPQISDFNTLEKFEIHWLQEWTQQVADYVLKFSREMAAINSIEKKAQYLRKFNYLINYVKSLYVESLLDKSFFLSLVLRFLKDGLPLQHKHVGELLSASADDSNRSMSSNNDGGDGGDDDNDDDDDLKARQGSWLNDVEMNYGQRLAALTLIKIFWNDLIKVDYLSKELSELLLLNYFFIDRWATSSSTPASYEKFALSDGLRFKLLKLISDTVKYLFELNCNIFIIPNYWMLIENSLVKIMLSPSQKGGSEKEHEEILKQLELIKYRNESLILNMKNEATVESNRMANRSASFSGFNSTAVSPAPSANVDNDYTFINRNSDDILNIIEKLDTLKFNEEFSNLLKPGRKGNKNWRLNLKVVLYWCVSPSRAYRDSIGDILFICNFLRNNVLAGLNKALKTEFDNEILEIIYQIAEDTNLNFVNSNLYVLINELYQLKLITIAAYLRKLIASGIFYLEPGTHQDLNNLPPVARTHLEILENLPVLNNRQCDSILKKWTPSGFDFKGKFTNGQAMLKKSIIDPIFNNSLSHHENVACTNYIRSLNVGLQFLLINWLTSEIKSTGSSATRLIHFTPAVVTNLYRFYSQTAGLTVFFKVIIPTILKNDGGMIIFYLDTLFLISKLTVRHFKLIKFIAGTHESGCTAYDIFKLIIQAYKDLSTREYDYFKFDNLWNFMDAVTEKAPESMDSTSNGGYHNNEQPLNKHSSSLVGKESLESPMHINTVEVPTTRLHTETRSASRRYTSTDFRNDIAYLRGLVPQPLSAEDAQEVRGVFDTDFSGSELQYWYDNFESLSEEKETALVKLLRSIMVSDHAFTTKIKDFIVELVKTSTDFQRITTFLKKMNIYDIVRTHELVKILLPVCSELGQESIIDEIVLGTEDSETKELTSSQQVLLQLNRHFYRVRSVKPYTMIILRGLLKGGAAYANDFFFKYKYPVLRFLNLAIATNTKVILSELYVKLPRDDCLELLNIQLGRTEDNFIKTLGDFEKFAPEIDEYNLPVCQVLLGVISNSLVSLDFVIVKEQLEHFMGALLASMNFRFSDSNSFFGELFSLMVWSHKVCILELLETKFLTETKFDNGIELYVTPTSQQNLLPPLNDFFKKFATSSSSSANSVASDKSLVQRLSDFINKLVDVVNSEAITEPTPNISSAISVFLRILIIHKLSLCEYISSWTTDELVISFVSKLIELLNSNYLNNNAEKLRILLYDLLLLMKSGITQEIHSSRDTELSDTTSPQTQSHQPLKLQSQHQDKDDHSEGTSPKSKDSKIENASMVSLIQNLFDLPEPSTANPFSAYLNDSLVKCSIMLDSNELEHGGDISVFNNRGLVLKSTRNDNPELPPFDQNNLMKSKSKQLKEFKFKSFEVLEDIGANSLNDGCLNLQLFDAYTTRENPP
Length1645
PositionKinase
OrganismCandida viswanathii
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
Aromaticity0.10
Grand average of hydropathy-0.276
Instability index38.97
Isoelectric point6.00
Molecular weight187604.42
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21680
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     108.92|      31|      31|      15|      45|       1
---------------------------------------------------------------------------
   15-   45 (55.54/38.73)	YSRSSYSNSSTKDEILAMKYLMQEPDLPIYP
   49-   79 (53.38/36.90)	HARKSSSASSTTNLTDTKTHTLQDQVEPAYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.36|      29|      31|    1322|    1352|       2
---------------------------------------------------------------------------
 1322- 1352 (47.78/37.76)	KFLTETKFD.NGIELyvTPTSQQNLL....PPLNDF
 1355- 1380 (33.65/19.01)	KFATSSSSSaNSV......ASDKSLV....QRLSDF
 1580- 1609 (35.93/20.87)	..LKSTRND.NP.EL..PPFDQNNLMksksKQLKEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.75|      27|      31|     980|    1007|       3
---------------------------------------------------------------------------
  980- 1007 (43.04/33.15)	VPTTrLHTETRSASRRYTSTDFR.NDIAY
 1012- 1039 (42.71/27.69)	VPQP.LSAEDAQEVRGVFDTDFSgSELQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.63|      19|      29|     265|     289|       7
---------------------------------------------------------------------------
  265-  289 (25.00/31.31)	NTLEKfEIHWLQEWtqqvaDYVLKF
  297-  315 (32.63/19.94)	NSIEK.KAQYLRKF.....NYLINY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.85|      11|      32|     878|     888|      11
---------------------------------------------------------------------------
  878-  888 (19.47/12.81)	LTVRHFKLIKF
  913-  923 (18.39/11.62)	LSTREYDYFKF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21680 with Med12 domain of Kingdom Fungi
Unable to open file!