<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21676
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLPFRKTETPLKADPISRVNSSSRLNQLGTTSTSSPSTPNPASYVTSSLNPQKNLPTNATNIKLKLQTQKDLDIFEQLPMVQKVKEYETLLNELSSDISQFKDDQLQLKIQRIIACNDVLKLQIEELNKHRNYSHQVDKLTEENRALENSSKTILKELVGYRNELKKLPKLPRPEKQLNQTVEVDDILKYAFKLAKFTKAPAAMANMPFQIHPNNYIWPAEDSLRRGMLAQASLQPDEIIRNELGVSEKETKEPPAKEDSDEEMEDVVAADEEKPAEAAENRLQHRGSFGGYDGAKKPEEAPAAPADLNLDLFDPDDEYSD |
| Length | 321 |
| Position | Middle |
| Organism | Candida viswanathii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.813 |
| Instability index | 48.29 |
| Isoelectric point | 5.06 |
| Molecular weight | 36257.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21676
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.81| 16| 26| 7| 26| 1
---------------------------------------------------------------------------
7- 22 (28.35/12.04) TETPLKADPISRVNSS
33- 48 (28.45/17.74) TSSPSTPNPASYVTSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.62| 25| 26| 148| 172| 2
---------------------------------------------------------------------------
124- 141 (21.52/11.24) ........IEELNKHRNYSHQVDKLT
148- 172 (39.33/25.96) ENSSKTI.LKELVGYRNELKKLPKLP
176- 201 (32.78/20.54) KQLNQTVeVDDILKYAFKLAKFTKAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.64| 14| 26| 71| 84| 4
---------------------------------------------------------------------------
71- 84 (24.71/17.45) DLDIF..EQLPM.VQKV
97- 113 (14.93/ 7.82) DISQFkdDQLQLkIQRI
---------------------------------------------------------------------------
|