<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21674
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MSDRLTQLQICLDQLIQQFNATINYVNTNSEPSLLDEDEPNSYSNMAANAPVPQAQQQQQAQQQQAPAQAQQSQQQSPAAQAQQSQGQSNSGGSKNAATPVQEEANFDNTVNELSTDLILKSRQINMLIDSLPGIGVSPEDQLSMIYELSADLKLVEEERIAKIKEKDALLKVLERLIADVATGISDTRM |
| Length | 190 |
| Position | Middle |
| Organism | Candida viswanathii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.587 |
| Instability index | 61.12 |
| Isoelectric point | 4.23 |
| Molecular weight | 20812.81 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21674
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.43| 16| 17| 54| 69| 1
---------------------------------------------------------------------------
54- 69 (29.87/11.71) QAQQQQQ.AQQQQAPAQ
72- 88 (25.55/ 9.10) QSQQQSPaAQAQQSQGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.46| 15| 17| 140| 154| 2
---------------------------------------------------------------------------
140- 154 (25.37/17.96) EDQLSMIYELSADLK
158- 172 (21.09/13.87) EERIAKIKEKDALLK
---------------------------------------------------------------------------
|