Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MESLDEIQWKSPEFIQERGLNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPLGMTFQQYFQTRLAEMTGVEFIIAYTKEPDFWIVRKQKRLDATNAVPLQDYYIIGANVYQAPRIYDVLSSRLLAGILSLKNSTDLLNEMTSYHVSDGGHSYNNSIHGKVGSKSQQSFAVSKSASNNTGINTMTPITLTTPLGATVPSTVSNNNNGAMSGIEITSGAFDSLLNDVVSNDEQVYIDEIPLYGKGSTIESLGLKVNTET |
Length | 262 |
Position | Head |
Organism | Candida viswanathii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.294 |
Instability index | 32.14 |
Isoelectric point | 4.80 |
Molecular weight | 29189.37 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21668 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.90| 17| 24| 176| 197| 2 --------------------------------------------------------------------------- 176- 194 (25.08/21.87) SKSASNNTGinTMTPITLT 203- 219 (29.81/11.61) STVSNNNNG..AMSGIEIT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DEIQWKSPEFI 2) NVLEYFSLSPFY 3) QVYIDEIPLY | 5 24 236 | 15 35 245 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab