<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21668
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MESLDEIQWKSPEFIQERGLNTNNVLEYFSLSPFYDRTSNNQVLMMQFQYQQIQIPLGMTFQQYFQTRLAEMTGVEFIIAYTKEPDFWIVRKQKRLDATNAVPLQDYYIIGANVYQAPRIYDVLSSRLLAGILSLKNSTDLLNEMTSYHVSDGGHSYNNSIHGKVGSKSQQSFAVSKSASNNTGINTMTPITLTTPLGATVPSTVSNNNNGAMSGIEITSGAFDSLLNDVVSNDEQVYIDEIPLYGKGSTIESLGLKVNTET |
| Length | 262 |
| Position | Head |
| Organism | Candida viswanathii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.294 |
| Instability index | 32.14 |
| Isoelectric point | 4.80 |
| Molecular weight | 29189.37 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.90| 17| 24| 176| 197| 2
---------------------------------------------------------------------------
176- 194 (25.08/21.87) SKSASNNTGinTMTPITLT
203- 219 (29.81/11.61) STVSNNNNG..AMSGIEIT
---------------------------------------------------------------------------
|