Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MTTGTLTSTPNNQPLIKSAENVSNLIESFIELGVLVHDNQGTPQSNQATVNKLNQLINQLKETSSANEQLKDYPIPIDVISYIEDGRNPDIYTREFIEVNAKNNARLKGKMNGFKTLRDVFGEKLKLEFPDLEKSVDDIVKRTSVEGQTTHSNNNNGLANGNSES |
Length | 165 |
Position | Middle |
Organism | Candida viswanathii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.701 |
Instability index | 24.67 |
Isoelectric point | 5.08 |
Molecular weight | 18291.08 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21666 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.01| 24| 53| 7| 33| 1 --------------------------------------------------------------------------- 7- 33 (32.02/30.61) TSTPNNQplIKSAENVSNLIeSFIELG 63- 86 (42.99/27.49) TSSANEQ..LKDYPIPIDVI.SYIEDG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 81.44| 24| 46| 90| 113| 2 --------------------------------------------------------------------------- 90- 113 (40.78/20.98) DIYTREFIEVNAKNNARLKGKMNG 138- 161 (40.66/20.90) DIVKRTSVEGQTTHSNNNNGLANG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EQLKDYPIPIDVISYIED 2) IYTREFIE | 68 91 | 85 98 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab