<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21658
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MVTAVLLVQKATPETITQFHDQISNELPTTKGKWSFNFKIFKNNQYSIPLVLADTHTQAPESKYLYTLSPSYLPDSTISLVNGRSAGVFTNSIEEEINELGHPTELSIPNEHLHKGATTGLNDRFDVFVGAKLQSLWSQRQLIKGDGGQIYELENGNLSIRTSNVFLHGVFRGLLLEIELSKFDGKNNDVKEKFTEIIKKYGFPEGDLCCDVLNSKFLDKYGDLCLQYSKSLASI |
Length | 235 |
Position | Head |
Organism | Candida viswanathii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.297 |
Instability index | 27.25 |
Isoelectric point | 5.70 |
Molecular weight | 26340.52 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21658
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.66| 22| 31| 168| 189| 1
---------------------------------------------------------------------------
168- 189 (39.44/23.63) HGVFRG.LLLEIELSKFDGKNND
201- 223 (37.22/21.97) YGFPEGdLCCDVLNSKFLDKYGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.74| 19| 35| 9| 31| 2
---------------------------------------------------------------------------
9- 31 (28.10/31.69) QKATPETITQFHDQIsnelPTTK
45- 63 (32.64/24.32) QYSIPLVLADTHTQA....PESK
---------------------------------------------------------------------------
|