<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21651
| Description |
Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MQPKSIALLQKIDNIIETIILKFSNIFENLQNANKTTETLAMESVTMENNCIQIIRLCQDLISISRNLKEVWVLNSIKVTQEKPEWKQAEIDSLFTSFNLLTDKIAQFEMTADGKANGERFTSSILGS |
| Length | 128 |
| Position | Head |
| Organism | Candida viswanathii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.131 |
| Instability index | 33.59 |
| Isoelectric point | 4.99 |
| Molecular weight | 14540.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21651
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.27| 11| 19| 9| 19| 1
---------------------------------------------------------------------------
9- 19 (17.63/ 9.61) LQKIDNIIETI
30- 40 (17.64/ 9.61) LQNANKTTETL
---------------------------------------------------------------------------
|