Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MANPNDPPLSEIQWRSPPILAHMGGLHSNTILFYFAESPFFERTSNNAVIMSQAMNNVSMYHFIQTREAFEGRLKTMSGLEFVVGEEPAETGPGMGTGVWVIRKQTRRKRYPEDDEITIHASFFVVGENIYMAPCLSDILASRIMTISSAISKALSAAEGARKWSASTGHLYHIPSTQNTTRRKLSSDGDTPTGPDTPAKATATTTTTATAPQKANELSLERASEEAFLTHMRHGGEYIDENPITGRPGEFHLSSTGRKAVPPPKLNAGSAMGAMNGPTLDTKVEEKKDAKTEKSPNLTDEERRSPAIALGLLVYYEPVSSDYGAMLQLSTSYEDNIPPPSTKIHRDKP |
Length | 349 |
Position | Head |
Organism | Ophiocordyceps polyrhachis-furcata BCC 54312 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.526 |
Instability index | 52.32 |
Isoelectric point | 6.09 |
Molecular weight | 38186.51 |
Publications | PubMed=26511477 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21644 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 81.47| 23| 74| 242| 264| 1 --------------------------------------------------------------------------- 242- 264 (43.66/22.37) NPITGRPGE.FHLSSTGRKAVPPP 317- 340 (37.81/18.61) EPVSSDYGAmLQLSTSYEDNIPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.44| 27| 183| 89| 116| 2 --------------------------------------------------------------------------- 89- 116 (46.06/30.98) AETGPGMGTGVWViRKQTRRKRYPE..DDE 274- 302 (41.38/23.36) AMNGPTLDTKVEE.KKDAKTEKSPNltDEE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AIALGLLVYYE 2) TKIHRDKP | 307 342 | 317 349 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab