<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21629

Description Uncharacterized protein
SequenceMTSRPPIGVLPRQPQRAPASHSAVQRPSKHHQRSLSQQYLAPSASPAVRRDSHPEAPGEPSDVPHPAAAAAAAQTRHHASTPRRGTSKLRLELSNNDWDPDLATTSDSPQILTPSRAAPVLAPPVSDADKVSPAQSRGSQYDDNPPIPLPKRRLQLPERAVSTPRPCTAVVAPTKKDARPRPYTVEVPSSAPRFVSIHKHDIPNRDPFSKGLHTGHADFFPWSGHHHEDEWSSEAIQKGTWDRGAQNETSSARLAVLPALKQKSGLNALSTIFMGVMNQRRFRGQILSPSTFKPPPRVTLTDTKREVWLKDLANPTISLRRLSRTIPHGIRGRTLLDQCLNKNVPTERAVWLAKCVGANEIRAFKRKGAGGAFVMGGESKWVRDWTVFVEQFVETVVSAFGEPDWKTRVTYAIRLATNLYSEHLMDRDHYLDWITSNLESSPQSRMPMWILIAQITWADLVRSRKYGRRLVYTLLAQLNNIHNDPDRDILIQLSSQLTGLLKTLLRSNPESFVAPKLWPKHRDALKAFLAPDDALSQDAWQRVDGRNARLSVGGCNTASPPAGRQHLIKLLDSTIQGHTDRELASKCLTVTNDKAELVKTLVEWATSVHRPGLAKLYVAVSLIKAWAASDATSVIVDLLDHVPSSNRLRKKAIFHLVSELIRAGLFSVPQYIKWLIGRGGLHDAAEIDADEGPCSSRLLVELPIHCLSESQRLQRTNLLRRAGQYSTAEEAKDMANALRCVDGSLGLSQHLGNKDGASTKCLSMPKLLRRISNSSKAVQTSIGAHLRDVLTPELLAKVEPVVALSTFSSARLVLETARDFGSLSQVLKSYAAASDVEVLAACADTVNSLLDVFLAMGSADALFSALTGRLKSLNREQAAAARPLLVALASLARRLPNRGAVAQQLQRELAQSERSKAIDACSPVSDSMALQAQNGESEVSEQIDKLLASGNTVDPPTMNRLFRNIIPKLEAGWAKADGGRRVFASLLARLRIFDAQHFDKLMADWVSHVGTLKDRPRLLELFPLLISLGCLSIPTVLRSANSVTSTDPGSPSDASSVYLQELLQLIVMKLPRAGRLDTAETYRFEIQQRTARLEHGGALLSLIRNAVAEYAAVVGSRKDCPLDDTFCRDCLVETLRYLVVTDSSAVAKVLDAGTLAAGAVEFVDQMVTRLLAPEGDGGSQESFDQLLSLSNELTMPFCQLKLDVYLSGAEKSSSRLEGFARAMDRAIEARNIAWTKMLPCLSQDITRSLSMQAHARFLGLIPSLKSDEEASSEQAVDLAENLLGVIEAITWPKSAQLTAALAEKLCDLWGSYLEPSGRRDGGGGGGGDDDDDDDDDDDDDDDDDDDDDDDDDDGDGAGSQDDVVRARIILVLCGLLLELDSRRRGSLSQQVLDVATLLVDGLPDEARMQCAKNILFLSGGGAGGGAGGAGGGGNTSSDPRLYYLFSLQQPTWAENLKLAHKERASIAYSAAARGMSTLYGIGPASSERLSPYVLRRWEVLSEPTPNVGENDTSLSLGLFEAIKMQ
Length1525
PositionKinase
OrganismOphiocordyceps polyrhachis-furcata BCC 54312
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps.
Aromaticity0.05
Grand average of hydropathy-0.287
Instability index44.45
Isoelectric point6.59
Molecular weight166214.44
Publications
PubMed=26511477

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP21629
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.64|      12|      15|    1328|    1339|       1
---------------------------------------------------------------------------
 1328- 1339 (27.27/10.44)	DDDDDDDDDDDD
 1344- 1355 (27.37/10.50)	DDDDDDDDDDGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.27|      17|      21|      13|      29|       3
---------------------------------------------------------------------------
   12-   28 (30.92/14.66)	RQPQR.......APASHSAVQRPS
   29-   52 (21.69/ 7.96)	KHHQRslsqqylAPSASPAVRRDS
  175-  189 (24.66/10.12)	KKDAR........P.RPYTVEVPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.35|      21|      21|     434|     454|       4
---------------------------------------------------------------------------
  434-  454 (38.65/23.79)	IT.SNL.ESSPQSRMPMWILIAQ
  455-  477 (26.69/14.11)	ITwADLvRSRKYGRRLVYTLLAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.27|      20|      21|    1233|    1253|       5
---------------------------------------------------------------------------
 1233- 1253 (33.46/28.47)	A.WTKMLPCLSQDITRSlSMQA
 1255- 1275 (28.81/18.50)	ArFLGLIPSLKSDEEAS.SEQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.20|      19|      21|     873|     893|       6
---------------------------------------------------------------------------
  873-  893 (25.49/20.95)	L.NReqAAAARPLLVALASLAR
  895-  914 (27.70/15.76)	LpNR..GAVAQQLQRELAQSER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.22|      21|      21|     504|     524|       8
---------------------------------------------------------------------------
  504-  524 (36.56/19.55)	LLRSNPESFVAPKLWPK..HRDA
  528-  548 (28.00/13.12)	FL..APDDALSQDAWQRvdGRNA
  549-  565 (24.66/10.62)	RLSVGGCNTASP...PA..GRQ.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.71|      18|      21|     943|     962|       9
---------------------------------------------------------------------------
  943-  962 (27.36/19.30)	IDKLLASGNTVDPPtmNRLF
  966-  983 (33.35/17.29)	IPKLEAGWAKADGG..RRVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.68|      16|      21|    1158|    1173|      10
---------------------------------------------------------------------------
 1158- 1173 (27.63/17.09)	GAVEFVDQMVT...RLLAP
 1178- 1196 (23.05/13.04)	GSQESFDQLLSlsnELTMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.92|      18|      19|     751|     769|      13
---------------------------------------------------------------------------
  751-  768 (31.62/20.64)	LGNKD.......GASTKCLSMPKLL
  771-  795 (23.31/ 8.18)	ISNSSkavqtsiGAHLRDVLTPELL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.39|      18|      21|    1058|    1076|      17
---------------------------------------------------------------------------
 1058- 1076 (25.86/20.38)	YLQELLQLiVMKLPRAGRL
 1082- 1099 (31.52/20.05)	YRFEIQQR.TARLEHGGAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.97|      24|      42|     303|     329|      22
---------------------------------------------------------------------------
  303-  329 (39.08/39.57)	TKREVWLKDL..ANPtisLRRLSRTIPHG
  346-  371 (38.89/29.30)	TERAVWLAKCvgANE...IRAFKRKGAGG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21629 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GRRDGGGGGGGDDDDDDDDDDDDDDDDDDDDDDDDDDGDGAGS
2) MTSRPPIGVLPRQPQRAPASHSAVQRPSKHHQRSLSQQYLAPSASPAVRRDSHPEAPGEPSDVPHPAAAAAAAQTRHHASTPRRGTSKLRLELSNNDWDPDLATTSDSPQILTPSRAAPVLAPPVSDADKVSPAQSRGSQYDDNPPIPLPKRRLQLPERAVSTPRPCTAVVAPTKKDARPRPYTVEVPSS
1317
1
1359
190










Molecular Recognition Features






MoRF SequenceStartStop




1) AVRRDSH
2) HPAAAAAAAQTR
3) MTSRPPIGVLPRQPQRAPASHSAVQRPSKHHQRS
47
65
1
53
76
34