<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21627
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSVHPQTPQSPCRFSPATSSDSVMGLAVASAASASASAAAAASAAAAAGSTTSSSCSLATLPTPAHSVNGANSQLDLGLVDSPHKRKRTLDDGGSGRDRKKMHRDDDDDDDDRMGIEDLHLDVGRKYLLCQNTYPESLPPTSEDLYQMFGLTALAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKNEDAPSDFLAMLAVPELEWNVHQVKGRDICQGLSEATLSNLGRAVTLSRGSLSKSVWDSSVLGDLAPAASDGSKPQSAKATAPSTPLASTPNAMGRSKAQLPVGAGDVARPRRNNKKRSYGDSSFEGYGEGYPDDDAGVDTGYSTGEGDGGQKRRKKNPSNSPTYSAMRQQSYGPGMVGA |
| Length | 372 |
| Position | Head |
| Organism | Ophiocordyceps polyrhachis-furcata BCC 54312 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.663 |
| Instability index | 48.63 |
| Isoelectric point | 7.09 |
| Molecular weight | 39026.67 |
| Publications | PubMed=26511477
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21627
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.46| 16| 16| 27| 42| 1
---------------------------------------------------------------------------
27- 42 (22.64/11.16) A...VASAASASASAAAAA
44- 59 (24.99/13.13) A...AAAAGSTTSSSCSLA
256- 274 (19.82/ 8.79) DlapAASDGSKPQSAKATA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 270.17| 83| 218| 62| 150| 2
---------------------------------------------------------------------------
62- 150 (137.58/71.66) P.TPAHSVNGA....NSQLDLGLVD..SPHK..RKRTLDDgGSGRDRKKMHRDDDDDDDdrMGIEDLHLDVGRKYllcQNTYPESLPPTSEDLYQMFG
275- 366 (132.59/56.69) PsTPLASTPNAmgrsKAQLPVGAGDvaRPRRnnKKRSYGD.SSFEGYGEGYPDDDAGVD..TGYSTGEGDGGQKR...RKKNPSNSPTYSAMRQQSYG
---------------------------------------------------------------------------
|