Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSVHPQTPQSPCRFSPATSSDSVMGLAVASAASASASAAAAASAAAAAGSTTSSSCSLATLPTPAHSVNGANSQLDLGLVDSPHKRKRTLDDGGSGRDRKKMHRDDDDDDDDRMGIEDLHLDVGRKYLLCQNTYPESLPPTSEDLYQMFGLTALAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKNEDAPSDFLAMLAVPELEWNVHQVKGRDICQGLSEATLSNLGRAVTLSRGSLSKSVWDSSVLGDLAPAASDGSKPQSAKATAPSTPLASTPNAMGRSKAQLPVGAGDVARPRRNNKKRSYGDSSFEGYGEGYPDDDAGVDTGYSTGEGDGGQKRRKKNPSNSPTYSAMRQQSYGPGMVGA |
Length | 372 |
Position | Head |
Organism | Ophiocordyceps polyrhachis-furcata BCC 54312 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Ophiocordyceps. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.663 |
Instability index | 48.63 |
Isoelectric point | 7.09 |
Molecular weight | 39026.67 |
Publications | PubMed=26511477 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21627 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 67.46| 16| 16| 27| 42| 1 --------------------------------------------------------------------------- 27- 42 (22.64/11.16) A...VASAASASASAAAAA 44- 59 (24.99/13.13) A...AAAAGSTTSSSCSLA 256- 274 (19.82/ 8.79) DlapAASDGSKPQSAKATA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 270.17| 83| 218| 62| 150| 2 --------------------------------------------------------------------------- 62- 150 (137.58/71.66) P.TPAHSVNGA....NSQLDLGLVD..SPHK..RKRTLDDgGSGRDRKKMHRDDDDDDDdrMGIEDLHLDVGRKYllcQNTYPESLPPTSEDLYQMFG 275- 366 (132.59/56.69) PsTPLASTPNAmgrsKAQLPVGAGDvaRPRRnnKKRSYGD.SSFEGYGEGYPDDDAGVD..TGYSTGEGDGGQKR...RKKNPSNSPTYSAMRQQSYG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GQKRRKKNPSNSPTYSAMR 2) RDRKKMHR | 343 97 | 361 104 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab