<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21620

Description Mediator complex subunit (Fragment)
SequenceMDISLNEAQKQHVRVNAQKQLVPPEENGLLFFPLVNMYDYLHLCCLNMQLEILYIQAAMLAKTRWINQLKVQMNQERTKLTLVYWRGGSPASRWASQSHSNKNTTIEISIRDADPFALSMSMRDDWKGLIQKAGIGASIRLSEMPVQDRPKVLASLKYPKHMLEVLWDGRPELYTDQPLLNPSHLNVEQLVLHATNHHGQCMINQFRSLLVSQKDFLQENGLYLAEESSLVIRYRHAKYISIESDARTGRVKAFEASDGCHEGDFKLRSLEDKLNNDPEHIARHLLWLRSEVVVREVISLAKQLNLQPYHPSHMNLRPEDIQKLFGDLTEAKQVNYPSHCIFLQFSQFEDCTTNAFLLLIQSSKTYDASGLYQTIVDLTYLECDQLWQDQFMDTKRHKKQRLSYEQPIDRLSIDLRYLAKLDSLCQAYIMNRKIELQLQSYRLAYHTRPLLQSLTGIETHGMNHPAADKMEVVCVSQQDVLKTSSGTLDSWVQRLLPLLKNDIMIRSFGWWGQSGDCYVVVQDKLDADALHLKGHALGDHIALDRATGVVSFTYTQIDRCIEQFLVDWERLFMMANLARQVSSVWFKKYKDQLVFEATDLQSLRMTYAKHYGCTIRWDTITKGQQRQYQLDLFTHHTKQTPVTALPTQIRNPHWRIASFLRDVLNDNRDLIYFVQILFQTLPLMSCLERLEVKCIQEGDIGKVSIIPRAYDAVRVIFSSMYAIDIRFTDKSTLCLSDAAYASPFSSSTSSPPPAPYLLPSLQQKSDAISVAQQCKFIPFDQFSQLLDTLDKETFEPSVVPFQHGFLCELSKQHRHTSFYLSIVSGNLPSLA
Length831
PositionTail
OrganismRhizopus stolonifer (Rhizopus nigricans)
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Rhizopodaceae> Rhizopus.
Aromaticity0.09
Grand average of hydropathy-0.285
Instability index50.80
Isoelectric point6.86
Molecular weight95771.75
Publications
PubMed=29674435

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP21620
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     160.64|      47|      73|     510|     558|       1
---------------------------------------------------------------------------
  510-  558 (75.15/60.92)	WWGQSGDCYVVVQDKLDADALHLKGHaLGDHIALDRATGVVSFTYtQID
  585-  631 (85.49/59.62)	WFKKYKDQLVFEATDLQSLRMTYAKH.YGCTIRWDTITKGQQRQY.QLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.44|      22|      27|     288|     313|       2
---------------------------------------------------------------------------
  288-  310 (33.43/25.79)	LRSEVVVREVISL..AKQLNLqPYH
  316-  339 (35.01/14.56)	LRPEDIQKLFGDLteAKQVNY.PSH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.68|      29|      35|     377|     411|       3
---------------------------------------------------------------------------
  377-  411 (45.78/41.23)	DLTYL.ECDQLWQDQFMDtKRHKKQRLSYeqpidRL
  414-  443 (47.90/27.19)	DLRYLaKLDSLCQAYIMN.RKIELQLQSY.....RL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.89|      12|      26|     118|     129|       9
---------------------------------------------------------------------------
  118-  129 (23.89/14.61)	LS.MSMRDDWKGL
  141-  153 (18.00/ 9.27)	LSeMPVQDRPKVL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP21620 with Med14 domain of Kingdom Fungi

Unable to open file!