<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21619
| Description |
Uncharacterized protein (Fragment) |
| Sequence | FYHYTDKASTATLPKLMIHPYIPTTTEQETNILSVLLRTKLIPDIEKLEAETQAAIARELVDPQANHNTRMDDEQLIKDQLDQWTALRDRHDRLAADAAHSGKSEVVGSDLKKLASAAKK |
| Length | 120 |
| Position | Head |
| Organism | Rhizopus azygosporus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Rhizopodaceae> Rhizopus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.592 |
| Instability index | 29.12 |
| Isoelectric point | 5.94 |
| Molecular weight | 13491.09 |
| Publications | PubMed=29674435
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21619
No repeats found
No repeats found
|