<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21609
| Description |
Uncharacterized protein |
| Sequence | MGDRLTQLQDAVDQLAQQFVACLHYVNKRHDLEILGPNDKVREVKDIPPEVDSLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQERYIKELEEDLKVAEAQRQEAIKEKDQILSELDGVIRSIRRP |
| Length | 136 |
| Position | Middle |
| Organism | Fusarium sp. FIESC_28 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium incarnatum-equiseti species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.583 |
| Instability index | 61.27 |
| Isoelectric point | 4.52 |
| Molecular weight | 15603.47 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21609
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 116.66| 28| 33| 49| 76| 1
---------------------------------------------------------------------------
12- 40 (25.49/13.42) ..VDQL.AQQFVACLhyVNKRHDLEIlgPNDK
49- 76 (48.19/31.03) PEVDSLPPDEFRAGM..VELSQDLIV..KEQQ
85- 111 (42.98/26.99) PGLDNSEMDQERY.I..KELEEDLKV..AEAQ
---------------------------------------------------------------------------
|