Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MATLNLEDDELKALEQTLSKIAQLSSSIQSLRQDLLKSNLLPPPKSIQASAKILQKNLRSLLESTTENADLFNRMAIHPSTNYPGRVQENVLLQLLRKKLEPDVEELVSQGLETARLATPAGLESLENIWKELRSWLTDRVGHFAANENNDPYTAEERVNGTENVRTGLRKGIEDGDDDDDDEDEEEEDEDEEEQEPAAAPAQVRGPEPETLLWFAARGDFEVPRNVEYERKEEPYKGIYVYKGLQGVGVPPTAQVAPPQAQQDFVPS |
Length | 268 |
Position | Head |
Organism | Fusarium sp. FIESC_28 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium incarnatum-equiseti species complex. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.777 |
Instability index | 59.69 |
Isoelectric point | 4.41 |
Molecular weight | 30031.80 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21607 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.80| 25| 35| 20| 54| 1 --------------------------------------------------------------------------- 24- 48 (41.66/42.08) LSSSIQSLRQ..DLLKSNLLPP....PKSIQ 58- 88 (33.14/11.06) LRSLLESTTEnaDLFNRMAIHPstnyPGRVQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 106.19| 34| 35| 100| 134| 2 --------------------------------------------------------------------------- 100- 134 (49.58/29.48) LEPDVEELVSQGLETARLATPaGLESLENIWKELR 137- 170 (56.60/30.20) LTDRVGHFAANENNDPYTAEE.RVNGTENVRTGLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RNVEYERKEEPYKGIYVYKGLQGVGVPPTA 2) TLLWFAAR | 225 211 | 254 218 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab