<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21602
| Description |
Uncharacterized protein |
| Sequence | MSANYWQSTQCRFWNFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLNIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVYQPYRTITALRSELGLQEDEVQLARSVINDHFMTDLPLLYPPHIIAMVAMLLALVLRPNNSGPGQNASGAAAAAGLAAAQQALMRAQGQQASGGTADAATAEPKERQQQARVSRVQKFAKWLVDSNVDIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
| Length | 319 |
| Position | Kinase |
| Organism | Fusarium sp. FIESC_28 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium incarnatum-equiseti species complex.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.289 |
| Instability index | 54.20 |
| Isoelectric point | 8.96 |
| Molecular weight | 36487.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.98| 14| 22| 214| 227| 1
---------------------------------------------------------------------------
214- 227 (24.50/15.73) GQNASGAAAAAGLA
238- 251 (25.47/16.61) GQQASGGTADAATA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.98| 19| 22| 55| 76| 2
---------------------------------------------------------------------------
57- 76 (28.07/22.12) RLAKRLTIRQQS....MATAqVYM
78- 100 (26.91/10.70) RFYSKVEIRRTNpylvIATA.IYL
---------------------------------------------------------------------------
|