<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21592
| Description |
Uncharacterized protein |
| Sequence | MDTSTPTNLMDKHQKIISEILRSYRDLMNCVTVNGMDKEKQGDYEAQANKLNYRDPDTMAAAGLRTQRKFDELYESIKELLSLTRTIKELWVFGPVDRADEHRKEKEEQIDRDIGEITTLFNKIDANTMRELAEKNGGTWEPQGEAALTSAAPAPTGN |
| Length | 158 |
| Position | Head |
| Organism | Gibberella intermedia (Bulb rot disease fungus) (Fusarium proliferatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.852 |
| Instability index | 18.43 |
| Isoelectric point | 4.97 |
| Molecular weight | 17950.91 |
| Publications | PubMed=30202022
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21592
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.39| 21| 27| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (35.70/28.23) YRDlMNCVTVNGMDKEKQGD..YE
53- 75 (33.70/21.73) YRD.PDTMAAAGLRTQRKFDelYE
---------------------------------------------------------------------------
|