<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21573
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPPPMPPPDEQEFDQPQLIGGLPTPDLHAGNNLFWYFTSSPWFDSECINIDVYLNLRQNDPLVAEKIMNDPKLWQQRLDDQLEGTQYVIAGEGQGDGHPWLLQRQHKVKVTENDKERIENCVEGNWYTHGTKMLMAPSLLDIVQSRLLAVSTRMQQMTELSKNMTHWTPATGYSYFPPSYETAKAAATASRVGSPSLAPTDPDAVGSQSQGTGAAAQATDAAASTTEFSDALLLHSLNLTNAYEDEYMDENPLKGEPGAFVFEGTKTAVNARNKAQEQAAQSAQSAPAAPLKIDTATPSVAPSVVATPKAMATPVAVEGHSRKSSVAPGSKKKKDRRKSQGGLTSPTTPSVPQQQ |
Length | 355 |
Position | Head |
Organism | Stemphylium lycopersici |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Stemphylium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.592 |
Instability index | 50.97 |
Isoelectric point | 5.23 |
Molecular weight | 38459.49 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21573
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 107.59| 34| 56| 257| 290| 1
---------------------------------------------------------------------------
257- 290 (55.68/28.16) PGAFVFEGTKTAV..NARNKAQEQAAQSAQSAPAAP
314- 349 (51.90/25.86) PVAVEGHSRKSSVapGSKKKKDRRKSQGGLTSPTTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.49| 14| 16| 178| 191| 3
---------------------------------------------------------------------------
178- 191 (22.64/11.39) PSYETAKAAATASR
195- 208 (24.85/13.17) PSLAPTDPDAVGSQ
---------------------------------------------------------------------------
|