<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21560
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MEQAASLMLPLRPPKAKSSKKDNLPIRIAQINAQRGSFRNITEQSLQEEIKAKKEKGEEEDEKEERNEETANAIDATERQELLYKKRAEIIQFAAQAHMETQFALDFISLLLSKHAPRQAETSISPYLKQNVPMGSLNIDVVRAPQKSQSAIRDSQNVAXGWKMESFSASANRLLKAAARLESEVAAETKYWDQVLAIKDRGWKVCRLPRERQVLGVQYGFMEAAPTFRDRGLASLRRADDGTLVLDKGLVPSRARAVRVRVKKQGKVTGNSSLSQFVAAAVADDSVEKTILQSRDTLFEEELFHELTREARVLVSSGVTAHKDLIEFEYEAGEQILLDLVDLDDLKLEQETNSTENTGINNTEAEAIAHALRILLSCAHRQNLRRRSQFPPPLTNQKRPTPQYQILRPILSYMQHDAHVRSLQSFLQDVYQVLNSAGLPSKYTTSKFSSLQFNHSKIDQSSTAVETLLGQFMEPLESRFTGSMANPSSTYNIRIHTTMPDTSSRQLALGTDYELTIRLPNYPYTQPPSRIGLRHEVELLLLRLFTLDLITYISSISSQNATKAAAAAKDQPASKSLLVWESPFPYHGEISGMTQDGKPVKQLAIDLSRDSLSLCLKVRSQNGNTDQHHANDDGIEDDADFPQSEFVTGSGGLKYTRPPQRLTGGEILHIWRREDANKPSKTLAEVVEEISIV |
| Length | 693 |
| Position | Head |
| Organism | Talaromyces amestolkiae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces>
Talaromyces sect. Talaromyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.520 |
| Instability index | 55.49 |
| Isoelectric point | 6.48 |
| Molecular weight | 77574.68 |
| Publications | PubMed=28649280
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21560
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.69| 19| 36| 329| 347| 1
---------------------------------------------------------------------------
329- 347 (31.10/22.06) EYEA...GEQILLDLVDLDDLK
364- 385 (26.58/17.79) EAEAiahALRILLSCAHRQNLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.67| 25| 38| 469| 494| 3
---------------------------------------------------------------------------
469- 494 (40.22/30.44) LGQFMEpLESRFTG.SMANPSSTYNIR
509- 534 (41.44/25.79) LGTDYE.LTIRLPNyPYTQPPSRIGLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 154.38| 46| 463| 111| 157| 4
---------------------------------------------------------------------------
111- 157 (73.54/57.92) LLSKHAPRQAETSISPYLKQNVPMGSLNIDVVRAPQKSQSAIRdSQN
577- 622 (80.84/58.65) LLVWESPFPYHGEISGMTQDGKPVKQLAIDLSRDSLSLCLKVR.SQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.09| 13| 43| 239| 254| 5
---------------------------------------------------------------------------
239- 254 (18.17/19.99) ADDGtlvLDKGLVPSR
283- 295 (21.92/14.05) ADDS...VEKTILQSR
---------------------------------------------------------------------------
|