<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21554
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPHTGVFFIPSSPNAPHILGPLTERLRSVYGDEAIPIGRWGLEHKLMRDTPSCLPASAHAPNPAPQARYVQFLSMTNHPRLGFVYASEDDESQQPATTTGVGKGKTESGMIMSTVPIASSSEIFRHFVRCCEPIWCHRHTVTVTGTVYDVGDFRVRLGEVRQTQPQARPRGTILEVEWRGPSMVAAALAPVSSTSLGLEERNGDALAMDVDAEMNSAMETPYIPSEAEIQLEYEQISNLIREFWTRIYSSSAAENNQNKQLPATTREAILVPDVGHEIKQRIAQRRQPAWQERENRRRRKRREAIALDRSWGGXSEKQQQQQQDDEEEDVEAGVDLARQYMELFRFNR |
Length | 348 |
Position | Head |
Organism | Talaromyces amestolkiae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces>
Talaromyces sect. Talaromyces.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.637 |
Instability index | 62.18 |
Isoelectric point | 5.80 |
Molecular weight | 39209.53 |
Publications | PubMed=28649280
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21554
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.25| 17| 34| 252| 269| 1
---------------------------------------------------------------------------
252- 269 (24.02/18.80) AAENNQNKQlPATTREAI
289- 305 (30.23/19.05) AWQERENRR.RRKRREAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.52| 25| 33| 174| 199| 2
---------------------------------------------------------------------------
174- 199 (37.00/25.29) LEVEWRGPSMVAAALAPvSSTSLGLE
208- 232 (42.52/25.01) MDVDAEMNSAMETPYIP.SEAEIQLE
---------------------------------------------------------------------------
|