<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21550
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNAQLSSALDGLENKLNSLLTSLTTPAATGAPAAAIALLEADDVVSSALDTLRIHQANYAKILHLRTEAQNLEERIKTIVRDISGAGKEIAQATGENDDDDYEMDTDDEDEDNESDTDTESENGDTIGQQKRPQKGRKKEVDYKLLLEFARRISKYNIQAAADATSGVLGTTGSTTKKLQEKQLEDAKMIDANGLAEQEQQQQQPGGEQEEVTVGTVTKEATSWLEESADADRQYFMIPYPNEDRIRMGLMGQLQVAAVDGNADPEKEAERMVQEAEGIAGVASGPADVQPRPQTLADEAGMAAMNAGAHAVARPAAKPAAPAQPRPTLDLDLYDPEDDD |
| Length | 340 |
| Position | Middle |
| Organism | Talaromyces amestolkiae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces>
Talaromyces sect. Talaromyces.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.709 |
| Instability index | 38.38 |
| Isoelectric point | 4.30 |
| Molecular weight | 36607.69 |
| Publications | PubMed=28649280
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21550
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.31| 29| 31| 265| 293| 1
---------------------------------------------------------------------------
265- 293 (52.45/27.39) PEKEAERMVQEAEGIAGVASGP.ADVQPRP
298- 327 (44.86/22.47) DEAGMAAMNAGAHAVARPAAKPaAPAQPRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.07| 20| 39| 171| 193| 4
---------------------------------------------------------------------------
171- 193 (24.13/26.15) TTGSTTKKlQEKQLEDAkmIDAN
213- 232 (33.94/22.07) TVGTVTKE.ATSWLEES..ADAD
---------------------------------------------------------------------------
|