Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNAQLSSALDGLENKLNSLLTSLTTPAATGAPAAAIALLEADDVVSSALDTLRIHQANYAKILHLRTEAQNLEERIKTIVRDISGAGKEIAQATGENDDDDYEMDTDDEDEDNESDTDTESENGDTIGQQKRPQKGRKKEVDYKLLLEFARRISKYNIQAAADATSGVLGTTGSTTKKLQEKQLEDAKMIDANGLAEQEQQQQQPGGEQEEVTVGTVTKEATSWLEESADADRQYFMIPYPNEDRIRMGLMGQLQVAAVDGNADPEKEAERMVQEAEGIAGVASGPADVQPRPQTLADEAGMAAMNAGAHAVARPAAKPAAPAQPRPTLDLDLYDPEDDD |
Length | 340 |
Position | Middle |
Organism | Talaromyces amestolkiae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Talaromyces. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.709 |
Instability index | 38.38 |
Isoelectric point | 4.30 |
Molecular weight | 36607.69 |
Publications | PubMed=28649280 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21550 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 97.31| 29| 31| 265| 293| 1 --------------------------------------------------------------------------- 265- 293 (52.45/27.39) PEKEAERMVQEAEGIAGVASGP.ADVQPRP 298- 327 (44.86/22.47) DEAGMAAMNAGAHAVARPAAKPaAPAQPRP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.07| 20| 39| 171| 193| 4 --------------------------------------------------------------------------- 171- 193 (24.13/26.15) TTGSTTKKlQEKQLEDAkmIDAN 213- 232 (33.94/22.07) TVGTVTKE.ATSWLEES..ADAD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LADEAGMAAMNAGAHAVARPAAKPAAPAQPRPTLDLDLYDPEDDD 2) RQYFMIPYP | 296 233 | 340 241 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab