Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MQPRHRLERRLIFKANRKATRINTRLGGGSQDVQGGEIQRLFKMLNGSTYYVRVVGVVNEADFGAKAVDEKEDGYDYESQFWRMEWRDIPEAGTRSGVTSRLMVNAVLPQGDIISVMETWGYTFVNEYVIEGDVFIYNDTTIFLHRVLNYPEDPQDAPSPRTTLPPLKDFTLLDPSGSYLLQASISVQDGASPESATQRLYGLRDQLRTAVKLEQADRLSLDTRVK |
Length | 226 |
Position | Head |
Organism | Talaromyces amestolkiae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Talaromyces. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.496 |
Instability index | 35.48 |
Isoelectric point | 5.55 |
Molecular weight | 25669.61 |
Publications | PubMed=28649280 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21543 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.99| 10| 19| 104| 113| 1 --------------------------------------------------------------------------- 104- 113 (17.58/11.99) VNAVLPQGDI 125- 134 (17.41/11.82) VNEYVIEGDV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.28| 13| 31| 155| 167| 2 --------------------------------------------------------------------------- 155- 167 (24.63/16.05) QDAPSPRTTLPPL 188- 200 (22.65/14.26) QDGASPESATQRL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PRHRLERRLIFKAN 2) RLYGLR | 3 199 | 16 204 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab