<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21539

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMPTEQREEKQLEASLDALLSQVADLKNSLGSFIYKLENEYDRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARLGADAAQKQIQSLNKMCSNLLEKISKEEREAESGGLRPNKQTFNPADTNALVAAVAFGKGLSNWRPSGSSGPGQPGQPGAGTILAGASGLQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQRILPCSLGPGPLTLKVLFRLPVSSLAHSNSSSIWLPDTSI
Length310
PositionHead
OrganismLipotes vexillifer (Yangtze river dolphin)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Lipotidae> Lipotes.
Aromaticity0.04
Grand average of hydropathy-0.427
Instability index47.00
Isoelectric point6.54
Molecular weight33574.78
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364144

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats
>MDP21539
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.07|      27|      41|     195|     221|       1
---------------------------------------------------------------------------
  195-  221 (52.55/24.97)	SNWRP..SG..SSGPGQPGQ.P.GAGTILAGAS
  233-  265 (28.52/10.91)	SQQQPmlSGvqMAQAGQPGKmPsGIKTNIKSAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.19|      24|      27|      62|      87|       2
---------------------------------------------------------------------------
   62-   87 (32.97/31.15)	LNKvLKHEKTPLFRNQViIP..LVLSPD
   92-  117 (38.22/25.53)	LMR.QTEGRVPVFSHEV.VPdhLRTKPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.62|      20|      28|      10|      29|       3
---------------------------------------------------------------------------
   10-   29 (31.23/23.28)	QLEASLDAL.....LSQVADLKNSL
   35-   59 (27.39/19.54)	KLENEYDRLtwpsvLDSFALLSGQL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21539 with Med8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FSHEVVPDHLRTKPDPEVEEQEKQLTTDAARLGADA
2) LQQVQMAGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNI
103
223
138
261










Molecular Recognition Features






MoRF SequenceStartStop




NANANA