<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21533
Description |
mediator of RNA polymerase II transcription subunit 29 |
Sequence | MAASQQQASAASSAASVSGPGSAGGSGPQQQPQPPTQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGAL |
Length | 200 |
Position | Tail |
Organism | Lipotes vexillifer (Yangtze river dolphin) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Lipotidae> Lipotes.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.361 |
Instability index | 65.05 |
Isoelectric point | 5.86 |
Molecular weight | 21076.63 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21533
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.50| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (38.59/14.82) GPGSAGGSGPQQQPQPPTQ
40- 58 (35.92/13.40) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|