<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21506
Description |
Uncharacterized protein |
Sequence | MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKQELLSIPRTFRWQV |
Length | 130 |
Position | Tail |
Organism | Felis catus (Cat) (Felis silvestris catus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Feliformia> Felidae> Felinae> Felis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.388 |
Instability index | 39.46 |
Isoelectric point | 6.91 |
Molecular weight | 14744.57 |
Publications | PubMed=17975172
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21506
No repeats found
No repeats found
|