<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21483
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLSYLTTYHDNIPTTPPPTIPPSLSAPPLAKIPKNSSTPPVPATIAQNQTSPPPPTPNPHAQQAGEGEGGETDPALPAPDSPEIFAARQRELARDLVIKEQQIEYLVSVLPGIGSSEEEQERRIRELEGELRVVEGEREKRRRELGELRRRLGGVLGVLERGVY |
Length | 185 |
Position | Middle |
Organism | Aspergillus sclerotiicarbonarius (strain CBS 121057 / IBT 28362) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.588 |
Instability index | 75.17 |
Isoelectric point | 4.98 |
Molecular weight | 20302.63 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.80| 31| 34| 31| 64| 1
---------------------------------------------------------------------------
31- 64 (51.00/28.21) DNIPTTPPPTiP.PslSAPPLAKIPKNSSTPPVPA
68- 99 (55.80/23.29) QNQTSPPPPT.PnP..HAQQAGEGEGGETDPALPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.98| 14| 15| 140| 153| 2
---------------------------------------------------------------------------
119- 132 (19.53/10.71) IKEQQIEYLVSVLP
140- 153 (24.60/15.13) EQERRIRELEGELR
158- 170 (22.85/13.61) EREKRRREL.GELR
---------------------------------------------------------------------------
|