<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21467

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMRSRHVPSPGLLPSSNISPSLIQISLRRPRGSGCSGFGQPPLPSPFTPNSMSDRASSASFRVGPPSPSSPATGSLKQNQPLAVFSDRIPQTPTSPPLMSVSAQNYATNLISSQTSPKPATSQPANISSPPSSAPMSTQASQQPTVGTANSFPTPASSVSGHIPGATSFDEPEHADKPMGVGLSETGATTATMNAAAMQQTEHRRTDHDRHLGGMGPEIGVRDFADMNGEGDAMEIDREAPALSGHSGPSLESLQKDFSSAFHLCKSSHIATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPLAPGGLRHLTMWPDEEWQNQKVFGKEIKMADIDSALHTLQMKAMKMEPGTVPNNDYWEDVLGHEKPSKHVGSGDAGKKTPAPPSNGIRITQPNGTPGPMTDAERARPSRGRKRHYDENSFVGYGEGYADDDDDGAFYSNSEGIGKKKRKKVGRSDGDVDF
Length490
PositionHead
OrganismAspergillus ellipticus CBS 707.79
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.05
Grand average of hydropathy-0.719
Instability index55.04
Isoelectric point7.82
Molecular weight52053.43
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP21467
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     102.07|      21|      21|      30|      50|       1
---------------------------------------------------------------------------
   30-   50 (41.90/16.08)	RGSGCSGFGQPPLPSPF.TPNS
   54-   72 (32.65/11.02)	RASSAS.FRVGP.PSPS.SPAT
  119-  140 (27.52/ 8.22)	ATSQPANISSPPSSAPMsTQAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     134.01|      43|      68|     208|     274|       2
---------------------------------------------------------------------------
  146-  207 (63.79/46.80)	GTANSFPTPASSVSGHI.PGATSFDEpehadkpmgvglsetgattATMNAAAMQQTEHRRTDH
  230-  273 (70.22/26.31)	GDAMEIDREAPALSGHSgPSLESLQK...................DFSSAFHLCKSSHIATGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     156.01|      44|      68|     321|     365|       3
---------------------------------------------------------------------------
  321-  365 (76.50/37.11)	GRNKPVKHEPLAPGGlRHLTMWPDEEWQNQKVFGKEIKMADIDSA
  392-  435 (79.51/35.58)	GHEKPSKHVGSGDAG.KKTPAPPSNGIRITQPNGTPGPMTDAERA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.55|      15|      24|      77|      96|       4
---------------------------------------------------------------------------
   77-   96 (22.84/24.74)	QNQPLAVFSDRipqtpTSP.P
  103-  118 (23.70/11.81)	QNYATNLISSQ.....TSPkP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP21467 with Med19 domain of Kingdom Fungi

Unable to open file!