<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21463
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAQQLPSDQPQQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGINKSGEESDATADSADPDAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEENFRRDIIRPDVIANLAGTGIPGEQGDAAAAAETGEQEQEEEQPKTS |
| Length | 155 |
| Position | Middle |
| Organism | Aspergillus ellipticus CBS 707.79 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.549 |
| Instability index | 48.85 |
| Isoelectric point | 4.31 |
| Molecular weight | 17011.52 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21463
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.97| 18| 74| 51| 71| 1
---------------------------------------------------------------------------
51- 71 (23.16/21.79) GInkSGEESDATAdSADPDAQ
128- 145 (32.81/18.06) GI..PGEQGDAAA.AAETGEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.51| 32| 80| 14| 45| 2
---------------------------------------------------------------------------
14- 45 (56.86/39.24) PPPTLTNPRFTLELEFVSSLANPYYLSHLAVT
96- 127 (53.66/36.67) PGATLRALRLLQEENFRRDIIRPDVIANLAGT
---------------------------------------------------------------------------
|