<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21444
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPATVPPQTPHAAPALAKIPKTSSAPPVPASAPLAAQQQSNQTQQTPAENPAPVQPGAPEDTTAPGQGQDPTLPPAPDSPRTFAARQRELARDLVIKEQQIEYLISVLPGIGSSEAEQELRIKELERELRRWEGVRGERMQELKALRGRLEGVLGAMEVGVHGERA |
| Length | 198 |
| Position | Middle |
| Organism | Aspergillus uvarum CBS 121591 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.549 |
| Instability index | 64.12 |
| Isoelectric point | 5.15 |
| Molecular weight | 21410.84 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21444
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.14| 22| 23| 150| 171| 1
---------------------------------------------------------------------------
150- 171 (40.52/28.97) QELRI..KELERELRRWE.GVRGER
173- 197 (30.62/20.42) QELKAlrGRLEGVLGAMEvGVHGER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.15| 12| 17| 34| 49| 2
---------------------------------------------------------------------------
34- 46 (21.91/ 8.41) PAT..VPPqTPHAAP
52- 65 (19.25/ 6.16) PKTssAPP.VPASAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.90| 17| 21| 79| 99| 3
---------------------------------------------------------------------------
79- 99 (24.12/16.70) PAENPAPvqpGAPEdTTAPGQ
103- 119 (33.78/12.45) PTLPPAP...DSPR.TFAARQ
---------------------------------------------------------------------------
|