<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21436
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSPAIIPATTQNNAPAAPALAKIPKNSSAPPVPASAPLAAQQANQTQNQNETSTLQQQQQQGGSGVAGAGGSAEGQQAAADPNAPPAPDSPRTFAARQRELARDLVIKEQQIEYLISVLPGIGSSEADQEARIRELEGELRRWEGEREERIRELKQLRGRLEGVLGAMEVGIYGDRL |
Length | 208 |
Position | Middle |
Organism | Aspergillus saccharolyticus JOP 1030-1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.561 |
Instability index | 56.30 |
Isoelectric point | 4.84 |
Molecular weight | 22324.54 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21436
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.14| 13| 15| 163| 176| 1
---------------------------------------------------------------------------
163- 176 (22.03/19.53) RIRELEgELR.RWEG
181- 194 (20.11/11.86) RIRELK.QLRgRLEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 152.18| 47| 53| 60| 110| 2
---------------------------------------------------------------------------
60- 110 (76.11/42.67) APPVPASA.PLAAQQANQTQNQnetsTLQQQQQQGGSGVAGAGGSAEGQQAA
115- 162 (76.07/35.78) APPAPDSPrTFAARQRELARDL....VIKEQQIEYLISVLPGIGSSEADQEA
---------------------------------------------------------------------------
|