<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21413
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MTTATVDASSSSGIGNGSGGSGSGSGSGSGSGSGLPSLQPSMPPDSLRQANQLTFSRDLEFLSSLANPYYLNHLAVSDVLSSPAFLRYLNHLDYFRHPRYVRYLQYPQALHFLDLLQKEQNFRLACRDLGFVNEVMAKQVGHWATWRDPDPELAEHNEEQQEQQQQQQSATA |
Length | 172 |
Position | Middle |
Organism | Testicularia cyperi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Anthracoideaceae> Testicularia.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.584 |
Instability index | 54.94 |
Isoelectric point | 5.39 |
Molecular weight | 18975.62 |
Publications | PubMed=29771364
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21413
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.16| 15| 16| 60| 74| 1
---------------------------------------------------------------------------
60- 74 (28.29/16.22) EFLSSLANPYYLNHL
78- 92 (28.00/16.00) DVLSSPAFLRYLNHL
93- 104 (22.88/12.01) DYFR...HPRYVRYL
---------------------------------------------------------------------------
|