<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21397
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSASFRVGPPSPSSPAAGSLKQTQPLAYLSDHFPQSPTSPPLMSVSAQNYASHLVSSQASPNQATPQPANLSSPPSSAPMSAQASQQPPVGTANSFPTPASSVSGHIPSANSFDDSENFDKPIGPGIGDTSATTATMNAVAMQQAEHRRTDHDRQPGGMDIGVRDFAVGGASDAMEIDSEVPASSIRSGPSLESLQKDFSSAFHLCKSSHIATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKNEPGAPGGLRHMTMWPEEEWQNQKVFGKEIRVADIDSALHNLQMKAMKMEPGTVPNNEYWEDVLGHEKPSKHAGGGDAGKKSVAPPPNGIRVTQPNGTPVPFSEPDRSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKVPVLK |
| Length | 432 |
| Position | Head |
| Organism | Aspergillus sclerotioniger CBS 115572 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.719 |
| Instability index | 59.47 |
| Isoelectric point | 6.88 |
| Molecular weight | 45847.39 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21397
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.41| 18| 19| 84| 101| 1
---------------------------------------------------------------------------
72- 91 (25.64/11.48) QPANLSSPPSsaPMSAQASQ
92- 111 (24.77/10.83) QPPVGTANSFptPASSVSGH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.66| 11| 22| 14| 24| 2
---------------------------------------------------------------------------
14- 24 (22.41/10.13) PPSPSSPAAGS
39- 49 (23.25/10.81) PQSPTSPPLMS
---------------------------------------------------------------------------
|