<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21392
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYSTLSYLTTYHDNIPTIPPPDIPPSLSAPPLAKIPKNSSTPPVPATIAQHQTTTQTSPPPPTPNPQENPEGGETDPALPAPDSAELFAARQRELARDLVIKEQQIEYLVSVLPGIGSSEEEQERRIRELERELRGVEGEREQRRRELGELRRRLGSVLGVLERGVY |
| Length | 185 |
| Position | Middle |
| Organism | Aspergillus sclerotioniger CBS 115572 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.657 |
| Instability index | 70.18 |
| Isoelectric point | 4.90 |
| Molecular weight | 20549.83 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21392
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.00| 25| 38| 35| 64| 1
---------------------------------------------------------------------------
35- 64 (41.48/27.23) TI.........PPPdiPPSlsaPPLAKIPKNSST.PPVPA
65- 99 (39.52/15.76) TIaqhqtttqtSPP..PPT...PNPQENPEGGETdPALPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.38| 20| 20| 140| 159| 2
---------------------------------------------------------------------------
120- 138 (21.92/11.05) .KEQQIEYLVSVLPGIGS..SE
140- 159 (33.61/20.26) EQERRIRELERELRGVEG..ER
161- 182 (25.86/14.16) QRRRELGELRRRLGSVLGvlER
---------------------------------------------------------------------------
|