<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21388
Description |
Cyclin-like protein (Fragment) |
Sequence | MEECPQHIRFVVGEARGLWPEFIAPDVSKLGECEFSLISEMSSQLIIHHPYRTLSELQPELSLTSDEVALAWSVINDHYLTDLPLLYPPHVIAVMAIIVAVVFKPSQTSFHGSAAPLASAMRDGGMSILAALGDKNGNGPPPRIQRLIAWLAESEVDIKAVIECTQELVSLYEVWEQYSEKHCKELLGRMVKSKNLD |
Length | 197 |
Position | Kinase |
Organism | Aspergillus heteromorphus CBS 117.55 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | 0.052 |
Instability index | 48.20 |
Isoelectric point | 5.03 |
Molecular weight | 21908.02 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21388
No repeats found
No repeats found
|