<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21369
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLPNNLPRQHPRTPDQHAPTTPTNPHTTLSPPPNSKPIRSPLPPLSKIPKNSSTPPVPAGLPQASSQPAQASPPPPPPPAAGETQADGQGAAAAAAGTGGDGNEGPPAPDTPRTFAARQRELARDLVIKEQQIEYLVSVLPGIGSSEEQQERRIRELEGELRGVEAVREQRVRELAGLRRRLEAVLGGVERGFLGIGV |
| Length | 211 |
| Position | Middle |
| Organism | Aspergillus heteromorphus CBS 117.55 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.658 |
| Instability index | 62.60 |
| Isoelectric point | 6.33 |
| Molecular weight | 22325.82 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21369
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.55| 14| 16| 164| 179| 1
---------------------------------------------------------------------------
143- 156 (22.70/ 9.48) EQQIEYLVSVLPGI
164- 177 (24.85/12.93) ERRIRELEGELRGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.45| 16| 17| 62| 77| 3
---------------------------------------------------------------------------
62- 77 (32.37/11.37) PKNSSTPPVP...AGLPQA
81- 99 (28.07/ 9.02) PAQASPPPPPppaAGETQA
---------------------------------------------------------------------------
|