<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21356
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTTLYSHQHHHPPTPALDQPTPQSPPPFYMSSNHAPSNNHSDKYHHHHPSALSPPNSSVTSSFSGGPRSLHPSNTIPTPASSAANTVPATFEDNEADMMMMDEGSDTGSNKRRRTSSSSYDRTSQTMPPALRHRGDLPDGIPPPIPTEQELLSQPDVSPYHLVCSNRLFPFHPFPLHSCCFPGHFRDDLLDLYGLRDIANSVARKNPTTGAKNKLRKSFKGFLGGLAGKNVVVTKASQTEVEPGGEAGSGGGDYFATLLGFPDEEWRNLQVIGKEISKGIDMGKLRKGLSMGRGDIPGFDPSVLGLDEESQRRKTPYVGSTTPAIGAAVGTPGHANGSTPGGPSPAGDDRPKRAKRRRDDGGDDDNGVNGSVGGVAGGRNHGPGPGVGPGAIVDGAVWDGEKRKKKRKKVTNTPLNI |
| Length | 417 |
| Position | Head |
| Organism | Tuber magnatum (white Piedmont truffle) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes>
Pezizales> Tuberaceae> Tuber.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.782 |
| Instability index | 54.38 |
| Isoelectric point | 8.82 |
| Molecular weight | 44307.67 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21356
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 145.95| 32| 35| 7| 38| 1
---------------------------------------------------------------------------
7- 29 (43.53/18.01) ..........................HQHH.HP....PTPALDQPT..PQSPPPFY
30- 58 (40.64/16.33) MSSNHA..PSN..........nhsdkYHHH.HP......SAL........SPPNSS
59- 92 (30.25/10.26) VTSSFSggPRS...................lHPsntiPTPA.SSAA..NTVPATFE
98- 143 (31.53/11.01) MMMMDE..GSDtgsnkrrrtssssydRTSQ.TM....P.PALRHRGdlPDGIPP..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 292.84| 66| 67| 260| 326| 2
---------------------------------------------------------------------------
194- 253 (81.89/42.27) ......GLRD..IAN.SVARKNPTTGAK.NKLRKSFKGFL..GGLAGKNV.VV..T..KASQTEVEPGGEAGSGGGD
254- 324 (104.75/60.39) YFatllGFPDEEWRNLQVIGKEISKGIDmGKLRKGLSMGR..GDIPGFDPSVL..G..LDEESQRRKTPYVGSTTPA
325- 346 (32.21/11.78) IG.aavGTPGH...........................AN..GSTPG.GPS........................PA
347- 414 (73.99/37.42) .G...dDRPKRAKRRRDDGGDD.DNGVN.GSV.GGVAGGRnhGPGPGVGPGAIvdGavWDGEKRKKKRKKV.TNTP.
---------------------------------------------------------------------------
|