| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MPQEPPPGALSSAFPPPPTYYTHFTEENLAALKSHCLEDGTLPPADSLSDPLYYLVPPPPPDGSYRAFGEEWMVPERYPSLEEAGIRQLYPPTSMAAAAANGGWGGGVDKGKELTVDRTIELRRLSKSLLLNYLELVGVMGMAPEQFHEKTADLETILFNMHHLINEYRPHQARETLCLRMEEQLERTRREAEENRRVVAKVEDILAGLERVAKQADAICGGDGLGTGGLGGVVGEEKVDDGVAKARVRDMEAWEALVGMGG |
| Length | 262 |
| Position | Middle |
| Organism | Tuber magnatum (white Piedmont truffle) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Tuberaceae> Tuber. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.415 |
| Instability index | 53.21 |
| Isoelectric point | 4.83 |
| Molecular weight | 28681.14 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP21354
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.45| 27| 41| 5| 39| 1
---------------------------------------------------------------------------
5- 39 (48.57/40.11) PPpgalssafPPPPTYYTHFTEENLAALKSHCLED
57- 83 (55.88/30.71) PP........PPPDGSYRAFGEEWMVPERYPSLEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 111.96| 35| 122| 102| 141| 2
---------------------------------------------------------------------------
102- 141 (48.99/43.23) GGWGGGVdkGKElTVDRTIELRRLSKslLLNYLELVGVMG
228- 262 (62.97/37.47) GGLGGVV..GEE.KVDDGVAKARVRD..MEAWEALVGMGG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ADSLSDPLYYLVPP 2) YRAFGEEWM | 45 65 | 58 73 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab