Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MPQEPPPGALSSAFPPPPTYYTHFTEENLAALKSHCLEDGTLPPADSLSDPLYYLVPPPPPDGSYRAFGEEWMVPERYPSLEEAGIRQLYPPTSMAAAAANGGWGGGVDKGKELTVDRTIELRRLSKSLLLNYLELVGVMGMAPEQFHEKTADLETILFNMHHLINEYRPHQARETLCLRMEEQLERTRREAEENRRVVAKVEDILAGLERVAKQADAICGGDGLGTGGLGGVVGEEKVDDGVAKARVRDMEAWEALVGMGG |
Length | 262 |
Position | Middle |
Organism | Tuber magnatum (white Piedmont truffle) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Pezizomycetes> Pezizales> Tuberaceae> Tuber. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.415 |
Instability index | 53.21 |
Isoelectric point | 4.83 |
Molecular weight | 28681.14 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21354 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.45| 27| 41| 5| 39| 1 --------------------------------------------------------------------------- 5- 39 (48.57/40.11) PPpgalssafPPPPTYYTHFTEENLAALKSHCLED 57- 83 (55.88/30.71) PP........PPPDGSYRAFGEEWMVPERYPSLEE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 111.96| 35| 122| 102| 141| 2 --------------------------------------------------------------------------- 102- 141 (48.99/43.23) GGWGGGVdkGKElTVDRTIELRRLSKslLLNYLELVGVMG 228- 262 (62.97/37.47) GGLGGVV..GEE.KVDDGVAKARVRD..MEAWEALVGMGG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ADSLSDPLYYLVPP 2) YRAFGEEWM | 45 65 | 58 73 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab