<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21329
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MTASSSNPASQPAIAPQLEEKIEAVRSEKLLADAERRRIAVRAKNEKARRMVRRLESCDGNIADLLSQASDCLRTLVDATAHESAYAAHADVRSYNESEDELRKTFELRAQQWFATLHEVQLGLRSAVRNLRKAQMEPTQRDISAAAGGPASSSSSSSSVPASPALNHVGKAERGHGLGIHTTEASLSESSSSSRSSLLDAFVDVGLKGPDLIAEDKKATKSSLLHDTKLSLSALRMQEHSWQQLAEALGEIAERRQAGSRSSKGSQRATSLPKMSQGQKERVRSLANDLVAAKDSQDSRLMSALLQMGIGPTDDVGTMADSMRADSGRA |
Length | 330 |
Position | Head |
Organism | Acaromyces ingoldii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Exobasidiales> Cryptobasidiaceae> Acaromyces.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.565 |
Instability index | 67.23 |
Isoelectric point | 8.51 |
Molecular weight | 35486.22 |
Publications | PubMed=29771364
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21329
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 120.19| 33| 35| 152| 186| 1
---------------------------------------------------------------------------
4- 30 (27.90/ 9.63) .SSSNPAS.QPA......iAPQL.EEKIEAVRSEKL........
152- 186 (52.96/29.43) SSSSSSSS.VPA.......SPAL.NHVGKAERGHGLgiHTTEAS
190- 231 (39.33/16.64) SSSSSRSSlLDAfvdvglkGPDLiAEDKKATKSSLL..HDTKLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.86| 19| 26| 56| 81| 3
---------------------------------------------------------------------------
56- 74 (34.48/22.64) ESCDGNIADLLS..QASDCLR
83- 103 (27.38/ 7.21) ESAYAAHADVRSynESEDELR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.95| 30| 30| 263| 292| 4
---------------------------------------------------------------------------
263- 292 (48.69/30.52) SKGSQRATSLPKMSQGQKERVRSLANDLVA
296- 325 (51.26/32.49) SQDSRLMSALLQMGIGPTDDVGTMADSMRA
---------------------------------------------------------------------------
|