<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21325
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MPPRARDRTPTSPSPSPEPPLAGERREIAGDAPAAGPPGSASSALGPPDHGVAGAGAAAGAGAGATVMAGPTTTTSLDSGLHQVLPRPASEAARLELVDRVRLATEELYQLMMCASEIHEGAEDVIRIKINETMQTLQHVQDASTQPDLSQLVPDKVMAMVDQGRNPDIHTRNFVNRLVGDNQQLRGQLESFDLYRDTLRSKLASAFPEMTSDLEAIDAKALPAES |
| Length | 226 |
| Position | Middle |
| Organism | Acaromyces ingoldii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Exobasidiales> Cryptobasidiaceae> Acaromyces.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.402 |
| Instability index | 43.92 |
| Isoelectric point | 4.86 |
| Molecular weight | 23860.45 |
| Publications | PubMed=29771364
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21325
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.10| 22| 23| 26| 47| 1
---------------------------------------------------------------------------
26- 47 (39.96/19.69) REIAGDAPAAGPPGSASSALGP
50- 71 (37.14/17.79) HGVAGAGAAAGAGAGATVMAGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.51| 23| 24| 168| 190| 2
---------------------------------------------------------------------------
142- 165 (31.88/17.31) DASTQPDLSQLVPDKvMAMVDQGR
168- 190 (36.18/20.43) DIHTRNFVNRLVGDN.QQLRGQLE
193- 215 (33.46/18.46) DLYRDTLRSKLASAF.PEMTSDLE
---------------------------------------------------------------------------
|