<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21312

Description Uncharacterized protein
SequenceMSASVAGRYAHDRRGGGGTMLYDSGSSNNMHGSKLSLLEAGSSPAAHLEPSTARPGPSSAPITDFGPAINQGPTWRPRLHPGSTALGKPDFFPPDTDAEQLTEQVIRLGITNRPAVGNETMTANDMIYDRLTGANVLDTMGSMMDEILMRREELQRDKISPSSHRAPPRVTLNEVKLAAYMRDLGDPSVPLQRLARSVPHGYRGERMLDMLWMGGVAPTPASSSAAAAAAARSSATASQAASVLPQSTRNPVELHRAVWFVRVVGASEISSSRARQNSNYTAEWTGTFSGWLRKQLAELNIAPTASMYQAAHSSPASPAPTNRTPAHARSQPIAASSPYSASANGHSLISSRDSIILQQPDLEARWFAKWEYSIGLAQALVAESLLDIRVFALWVFEQLGTASLAQLPFVLTLAQEHAWVALDALILQRALLQSLCSCITELRKAEMPEDNKNTRLILKEACELVRFLFDSNSDAFVSPKLWSQYRATIRKVIDDSHDGVETSRAAAHRREKLNNIDRRAQACLLGDLVVSSDEVSAPRCDIELLDAFSVNETDVEALSDAYFARSKAQYSIQEKLCNVLIWATTQWRSGQHRPLLAARLVWTYHSRSQDASARLACGWRAVDLQTVLFDWLSSVDKAQRDRGNATLAVLRSLELESIIILVGELIRLGCFSFSKYLQRLTARGMTAGPTAPLKGTPLGSFEASHTSLNSEASLHQRVLRSVPLAAATPALSSQRRSAIYGTRLKESHEEASERRLRRELSNALPWLHGASPQEGNNASLPSELKEQIPHLWSASRYTLAKVISNDLMPSIRSLERSLTVDEICILEVILAHARDYIALSQLLSSQLLLITFMEDSEALEVLISCICKHALCFAALDTFHQLANAVSDLYIQCAGDDNSPWGAPCLEAYQRVAALRNLHRHLARNYEEEQTSASEGHCRTERRPSGHLHDQVLEIGRRLVSDLDVRAAMRSVQAIAGRVAGQSILSAALHLVSEGASDGAIIALVQWARLATWTASDLDAVLRSWASQSELMAANEGLELFLLRCVASGALLMRDLYASFVLPALELEAEENGAPPVEKQKNRSSRLATVAAIIKASSSPRETSAALRLDSRHRLRLEAESATVTGPSGNHSLLFRVLVLLLHLPNHDAAVLARNELLSNSSVRCCIMIKAFELFSIVSEVSRSVWGSNPSQVLSQVFASVNQAGLSTFNPSSIDAEMIFQRLDPWRCNLTVAEIAHISGKVANADASEHLRSQNALTSLSIAIFEPLCLVSNSNLQNQLIRHTKHISTFQGRLVDLCIEKLLRHLHSSSRRAGSTHSWLHDSLQTLAQVLHSQSRASISPHTLTLASQLLDAVAAGFERTSSSRDCRDPSLIPLDENVRASLACARLAGLWTSADARSTAPRLLEAMCACAANCSLEALNDFDVIVDAMSALMEDMPPDGVSSAQMSISSILGHVCVRSAMPDFAQARLQALAMPVTITTQTHSAGATSDIILASSMTSAAVKGNFSQVPFKAWELHDHMDADTLSRAQTRLPGSTILGAGSGTSHLPSVSMIDADEVGYAAVDLANSGSVSLLQVGAVKTRDRVASASGLNDHMYPARSHTSIGADEPEHWAAHESERTYGEGGAGDTTYARDARTGSDLLALDRARGDGGEAALIPEELRAADRALAQRALAAAAAEAAARAAQEAVKKAEAAAAVAAAAKVVQTTPQRPKPVPKGTRQAPATSAKSRKRKEPPDSPDTASRPSARGGRGRGRGRGKEARAV
Length1765
PositionKinase
OrganismCeraceosorus guamensis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Ceraceosorales> Ceraceosoraceae> Ceraceosorus.
Aromaticity0.05
Grand average of hydropathy-0.164
Instability index48.34
Isoelectric point6.93
Molecular weight190648.52
Publications
PubMed=29771364

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21312
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.47|      23|      26|    1302|    1327|       2
---------------------------------------------------------------------------
 1304- 1327 (39.04/27.17)	RHLHSSSRRAGSTHSWLHDSlQTL
 1329- 1351 (39.43/17.38)	QVLHSQSRASISPHTLTLAS.QLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.06|      23|      25|     747|     771|       3
---------------------------------------------------------------------------
  749-  771 (39.97/28.46)	EEASERRLRRELSNALPWLHGAS
  773-  795 (41.09/21.89)	QEGNNASLPSELKEQIPHLWSAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.46|      21|      25|     297|     317|       4
---------------------------------------------------------------------------
  297-  317 (37.40/19.78)	AELNIAPTASMYQ.AAHSSPAS
  319-  340 (34.06/17.32)	APTNRTPAHARSQpIAASSPYS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.03|      16|      25|     362|     377|       5
---------------------------------------------------------------------------
  362-  377 (31.25/17.70)	LEARWFAKWEYS.IGLA
  386-  402 (24.78/12.62)	LDIRVFALWVFEqLGTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.16|      22|      26|    1541|    1565|       6
---------------------------------------------------------------------------
 1541- 1562 (38.69/22.67)	AGSGTSHLPSVSMIDA.DEVGYA
 1567- 1589 (29.47/ 9.91)	ANSGSVSLLQVGAVKTrDRVASA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      74.72|      18|      19|    1015|    1032|       7
---------------------------------------------------------------------------
  996- 1014 (25.36/13.63)	ASD..GAI.IaLVQWARLATWT
 1015- 1032 (30.63/18.28)	ASD..LDA.V.LRSWASQSELM
 1033- 1053 (18.73/ 7.78)	AANegLELfL.LRCVASGALLM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.38|      17|      27|    1364|    1386|       8
---------------------------------------------------------------------------
 1364- 1386 (24.70/26.78)	SRDCRD..PSLipLDenvrASLACA
 1394- 1412 (27.68/13.23)	SADARStaPRL..LE....AMCACA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.92|      11|      15|      21|      31|       9
---------------------------------------------------------------------------
   21-   31 (21.48/14.76)	LYDSGSSNNMH
   37-   47 (19.44/12.44)	LLEAGSSPAAH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.53|      30|      31|     587|     616|      10
---------------------------------------------------------------------------
  587-  616 (52.81/28.59)	WRSGQHRPLLAARLVWTYHSRSQDASARLA
  619-  648 (50.72/27.18)	WRAVDLQTVLFDWLSSVDKAQRDRGNATLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      89.91|      24|      27|     857|     883|      11
---------------------------------------------------------------------------
  838-  857 (28.88/12.80)	AL.SQLLS...SQ.....LL....LITFMEDSE
  858-  884 (37.77/25.99)	AL.EVLISCICKH.....ALCfaaLDTFHQLAN
  885-  913 (23.26/ 8.98)	AVsDLYIQCAGDDnspwgAPC...LEAYQRVA.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     113.40|      26|      28|    1696|    1721|      12
---------------------------------------------------------------------------
  225-  249 (32.13/15.07)	.AAAAAAARSSATASQAA....SVLPQSTR
 1696- 1721 (44.21/23.81)	AAAVAAAAKVVQTTPQRP....KPVPKGTR
 1723- 1752 (37.06/18.63)	APATSAKSRKRKEPPDSPdtasRPSARGGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.78|      16|      26|     693|     711|      14
---------------------------------------------------------------------------
  693-  711 (22.51/22.21)	LKGTPLGsfeASHTSLNSE
  719-  734 (26.27/15.57)	LRSVPLA...AATPALSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.53|      14|      26|     429|     442|      15
---------------------------------------------------------------------------
  429-  442 (23.79/15.94)	RALLQSLCSCITEL
  455-  468 (22.74/14.86)	RLILKEACELVRFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.53|      18|      26|    1431|    1449|      16
---------------------------------------------------------------------------
 1431- 1449 (27.61/21.18)	SAlMEDMPPDGVSSAQMSI
 1460- 1477 (30.91/18.88)	SA.MPDFAQARLQALAMPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.44|      10|      26|    1115|    1124|      17
---------------------------------------------------------------------------
 1115- 1124 (15.30/ 7.83)	LRLEAESATV
 1142- 1151 (18.14/10.87)	LHLPNHDAAV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21312 with Med12 domain of Kingdom Fungi
Unable to open file!