<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21305
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MALPYNRPNAPAIFFRDPEYLANTGLTRLTALEYFSHSSFFDKRCTNEVLRMQNLARLGANAARRDPKELQLELRKFRGIEFVLAESLDGAETTASDLFIVHKRLREGSEDSQVKLLQVYFILSGDIMRAPDLYRLVGGRLVSVSSMVQPRGDLLRRHCETNLGAHCS |
| Length | 168 |
| Position | Head |
| Organism | Ceraceosorus guamensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Ceraceosorales> Ceraceosoraceae> Ceraceosorus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.265 |
| Instability index | 42.83 |
| Isoelectric point | 8.88 |
| Molecular weight | 19060.64 |
| Publications | PubMed=29771364
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21305
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.17| 18| 46| 16| 34| 1
---------------------------------------------------------------------------
16- 34 (26.88/21.94) RDPEYLaNTGLTRLTALEY
65- 82 (31.28/20.65) RDPKEL.QLELRKFRGIEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.09| 23| 104| 36| 60| 2
---------------------------------------------------------------------------
36- 60 (35.31/25.64) SHSSFFDKRctNEVLRMQNLARLGA
143- 165 (40.78/22.73) SVSSMVQPR..GDLLRRHCETNLGA
---------------------------------------------------------------------------
|