<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21301
| Description |
Uncharacterized protein (Fragment) |
| Sequence | SIDLISQLESDLALMLQIMTSSLHFLTHRSAHVQINNVIPLFQPTNLAQSHAANHLIDAETMSENIDELTDDLVLKAKEMESLLQRLPKQTNEDQVKRELEQIDEEMSVANQEYRDALRDA |
| Length | 121 |
| Position | Middle |
| Organism | Meira miltonrushii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Exobasidiales> Brachybasidiaceae> Meira.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.417 |
| Instability index | 50.21 |
| Isoelectric point | 4.52 |
| Molecular weight | 13808.36 |
| Publications | PubMed=29771364
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21301
No repeats found
No repeats found
|