<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21285
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEYENDADVHDHAADDGQDIDRDAAAQITNSLLPLPPSVYSRFTRDNVARYNVMKEAKENDLKNGEFDWENAEPAARLARQKIILERAAAAKEGITEEEKNVASGSNTKSTSLLPVPPWDILLAMEPPNVDWIKEDGHYSCFGDRWPVEESLPSLQEMGMAQIYPTSEDEEMDRPAILTSLLRTLLKSYLRLIDTVLSPPQAYLSTQNDPNTGAITNQEWLFTTQDKARQINDISINFMHLLNETRPLQAREQLRDLMRDQLNNRKQEAKLMRLQCQAIRTEIQSIKDGMRNEVG |
Length | 295 |
Position | Middle |
Organism | Meira miltonrushii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Exobasidiomycetes> Exobasidiales> Brachybasidiaceae> Meira.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.701 |
Instability index | 45.66 |
Isoelectric point | 4.73 |
Molecular weight | 33626.30 |
Publications | PubMed=29771364
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21285
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.90| 25| 79| 13| 37| 1
---------------------------------------------------------------------------
13- 37 (44.84/36.91) AADDGQDIDRDAAAQITN....SLLPLPP
90- 118 (38.07/30.12) AAKEGITEEEKNVASGSNtkstSLLPVPP
---------------------------------------------------------------------------
|