<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21281

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMQSKQASHQQASSEQYTDTQPPNKFLAAPNGKHLHSHANGGSTATTSHPSSSLAQTAVVAVSSTSSVMSPRAQAKSKAIVQDPLPGSGQHLSHSQLFRTPSPPPTSIDDLKAELNNEGDGVIPLAAIIERVASEAYDGLLNLGETMSSLPSSERRARIFDTALELRKQMIKLYVVIQWSRGANHMQHLKNINGLIHEQTYQTLDARDHLVETRNILPNARQRNHDIATAVEVLAKGEPSKLPAAIEKDSIPPKPFTDSQARAIIHELDEAIRVRLACDEPVPLRLKSSGCDVSDGRVRLTAPSLFSLSLTLSGAKEDDRWYLLTIQFDYNITGQGKDRFPQDLWEAQREGFIATANQVLEPRSAPPAAEGEEGGEAAAATVRVDRPIVRLFNFLQSQALEYQLDILAFQVTELVRLAWKGVLSWSWQDRTLVIDYWLRPAGEGARSGQTSLGPVKGGRVKLVVQPRKKETAIEELGRQIDEEGEDAVATEDGENCEHHLQLAVTWEVDDAPLPDRPDVFVDAQDLNAEALLLSVVTRHAEMAIAVFRDRVAASTLRRTISSMSSPSELILDLHATLTVCLSIDPKKGKLSLSQRSGGGGSDADVIAPTLSQSSSASRLREASDLINSSPASLVDVLFRLQTAAIRSDLEQKAAYLGLRSLRSLNLNQEEYTKFEVQPSHIHYLPLEQCPTYYLAFVIKNADVRASLVSAMPALYGGASTANPTGSAMELHSLQWLDIDKIAGAKKDGTSRAVLSSLDIGRLHSYAVALTISSQLQTQLRMRGVAFVLLPAVTMSPPGLLGSTCTRAEDVIPSMSARTIELFGPSAQVLLKPNALVRLGDYWNPASCYIEVVIRMRFNVKRVKAVRDQGLNSNMSSAGSLASVRFNAKRSELSLRTRNLGQALDIFALDWQRIAKIASLASQLSTQRCGVKDKGKGEQQRFHLLDYDVRSARFAYGSEHGLEALLYWEAGSEGEIGAAMLAQPQVMPSGYRLAFTSSDGSTNPHTRIQSYLEDLLNGSSSSPDWSALLFLLDSTIPILSTLGRLRDAALDDAASPDVEWLNATWYRVVFAEAYRLDVRIAKGGKVMVVQDAAAGGRELMASSKEGKSKGDDDAEIPELRQAMEAAAASSGAGGPSAGVLVLGQTMLCDLRRTRGKVAQATLTALVELVGRNVAEIEGLL
Length1178
PositionTail
OrganismJaminaea rosea
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Exobasidiomycetes> Microstromatales> Microstromatales incertae sedis> Jaminaea.
Aromaticity0.06
Grand average of hydropathy-0.218
Instability index47.74
Isoelectric point6.01
Molecular weight127903.31
Publications
PubMed=29771364

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21281
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     132.29|      42|     402|     584|     649|       1
---------------------------------------------------------------------------
  595-  638 (62.83/76.23)	SGGGGSDADVIapTLSQSSSASRLREASDLINSSPASLVDVLFR
 1128- 1169 (69.46/32.01)	SGAGGPSAGVL..VLGQTMLCDLRRTRGKVAQATLTALVELVGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.93|      23|      23|     272|     294|       2
---------------------------------------------------------------------------
  272-  294 (41.90/27.79)	RVRLACDEPVPLRLKSSGCDVSD
  296-  318 (38.03/24.49)	RVRLTAPSLFSLSLTLSGAKEDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.37|      16|     121|     221|     246|       3
---------------------------------------------------------------------------
  216-  232 (23.92/ 8.62)	LPNA.rQRNHDIATAVEV
  364-  381 (21.45/16.73)	APPAaeGEEGGEAAAATV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     128.57|      33|     598|     319|     355|       7
---------------------------------------------------------------------------
  319-  355 (60.24/48.25)	RWYLLtiqfDYNIT....GQGKDRFPQDL..WEAQREGFIAT.A
  899-  919 (21.10/ 7.22)	..................GQALDIFALD...W..QRIAKIASlA
  939-  977 (47.23/28.35)	RFHLL....DYDVRsarfAYGSEHGLEALlyWEAGSEGEIGA.A
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21281 with Med14 domain of Kingdom Fungi
Unable to open file!