<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21265
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYKLYKDYLQDPKSAPEPPPPIEGTYVCYGGNYTTDDILPSLEDQGVRQLYPKGPNIDFKKELRSLNRELQLHILELADILVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQRLLKESIGTLEDTGASFVLK |
| Length | 175 |
| Position | Middle |
| Organism | Prunus yedoensis var. nudiflora |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.632 |
| Instability index | 73.90 |
| Isoelectric point | 7.83 |
| Molecular weight | 20255.96 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21265
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.29| 13| 19| 7| 19| 1
---------------------------------------------------------------------------
7- 19 (31.05/14.85) P.PPPP...YYKLY.KDY
27- 44 (18.23/ 6.42) PePPPPiegTYVCYgGNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.25| 27| 44| 74| 106| 2
---------------------------------------------------------------------------
74- 106 (36.28/39.55) LRSLN.......RELQLHILELAdilVERPSQyarRVEDI
114- 147 (40.97/26.20) HHLLNslrphqaRATLIHILELQ...IQRRKQ...AVEDI
---------------------------------------------------------------------------
|