<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21263

Description Mediator of RNA polymerase II transcription subunit 12 isoform X1
SequenceMQRYHATGCTSAVNNSAIGGTSGRDSVRADSAALPANLSLASRRTSQLNPYKLKCEKEPLNGRLGPPDFHPQTPNCPEETLTREYVQKSREISLSQAQVFSKPLVFRCKEAIKKRFRAINESRAQKRKAGQVYGVPLVDTLLSKPGVFPEQRHCGEDLRKKWIEGLSQQHKRLRSLADHVPHGYRKRSLFEVLTRNNVPLLRATWFIKVTYLNQVRPGSAIISSGAPDKAQLSRTELWTKDVIDYLQYLLDELFSRNNSHSTSHNRDRSPQTLYAGSVPQRSDPASAVLDGEEPSLHFKWWYVVRLLQWHHAEGLLLPTLIIEWVLSQLQEKELLEIMQLLLPIVYGVLETVVLSQTYVRNLVGVAVRFIREPSQGGSDVVDNSRRAYTVSTVVEMLRYLILAMSEDVRKIGNGSAEVASAFRSKGFDAQYQSLAFDHVVSSIQKRADNLAKAASPSYPVHSIAKAVQALDRSLVQGDVRGAYRFLFEDPCDGVANESWITGVSPCLRTSLKWIGTATCHLFALCFSFVSGQHVISGIFELPHLVS
Length546
PositionKinase
OrganismPrunus yedoensis var. nudiflora
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.08
Grand average of hydropathy-0.268
Instability index45.10
Isoelectric point9.34
Molecular weight61163.11
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21263
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     114.66|      30|      31|      76|     105|       1
---------------------------------------------------------------------------
   76-  105 (51.18/34.35)	CPEETLTR.EYVQKSREISLSQAQVFSKPLV
  108-  138 (44.36/28.85)	CKEAIKKRfRAINESRAQKRKAGQVYGVPLV
  154-  168 (19.11/ 8.50)	CGED.LRK.KWIE.....GLSQ.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.64|      23|      27|     315|     337|       2
---------------------------------------------------------------------------
  315-  337 (39.15/20.01)	LLLPTL..IIEW.VLSQLQEKELLEI
  340-  365 (26.49/11.78)	LLLPIVygVLETvVLSQTYVRNLVGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.52|      24|      31|     398|     421|       3
---------------------------------------------------------------------------
  398-  421 (38.31/29.25)	RYLILAMSEDVRKIGNGSAEVASA
  430-  453 (39.20/30.10)	QYQSLAFDHVVSSIQKRADNLAKA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21263 with Med12 domain of Kingdom Viridiplantae
Unable to open file!