<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21259
Description |
Mediator of RNA polymerase II transcription subunit 23 isoform X3 |
Sequence | MGCSRQYLNSHWYARISSGNIVALLHSFFSNLPQEWLEGTHLIIKHLRPVTSVAMLRIAFRIMSPLLPKLANAHTLFSKTLSLILGMMVDVFGKNTQPPIPVEPLEIADLIDFFHHIIHYEGQGGPVQANSKPRPEVLSLFGRAAESLRPDIQHLLFHLKPDTNSSIYAATHPKLVQNAS |
Length | 180 |
Position | Tail |
Organism | Prunus yedoensis var. nudiflora |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.049 |
Instability index | 38.58 |
Isoelectric point | 9.17 |
Molecular weight | 20161.22 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21259
No repeats found
|